PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT1G66390.1
Common NameATMYB90, MYB90, PAP2, T27F4.14
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB
Protein Properties Length: 249aa    MW: 28100.1 Da    PI: 8.4893
Description myb domain protein 90
Gene Model
Gene Model ID Type Source Coding Sequence
AT1G66390.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding48.61.9e-151057148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd ll  ++ ++G g W+ ++ + g++R++k+c++rw++yl
      AT1G66390.1 10 KGAWTAEEDSLLRLCIDKYGEGKWHQVPLRAGLNRCRKSCRLRWLNYL 57
                     79********************************************97 PP

2Myb_DNA-binding48.81.7e-1563108148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rgr + +E +ll++++k+lG++ W++Ia +++ gRt++++k++w+++l
      AT1G66390.1  63 RGRLSNDEVDLLLRLHKLLGNR-WSLIAGRLP-GRTANDVKNYWNTHL 108
                      8999******************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.607.3E-21559IPR009057Homeodomain-like
PROSITE profilePS5129418.103557IPR017930Myb domain
SuperFamilySSF466891.2E-277104IPR009057Homeodomain-like
SMARTSM007171.0E-13959IPR001005SANT/Myb domain
PfamPF002491.7E-141057IPR001005SANT/Myb domain
CDDcd001676.74E-101257No hitNo description
PROSITE profilePS5129424.80658112IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.8E-2260111IPR009057Homeodomain-like
SMARTSM007177.7E-1562110IPR001005SANT/Myb domain
PfamPF002497.5E-1463108IPR001005SANT/Myb domain
CDDcd001671.59E-683108No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0030154Biological Processcell differentiation
GO:0080167Biological Processresponse to karrikin
GO:0005634Cellular Componentnucleus
GO:0000981Molecular FunctionRNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0001135Molecular Functiontranscription factor activity, RNA polymerase II transcription factor recruiting
GO:0005515Molecular Functionprotein binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000293anatomyguard cell
PO:0009009anatomyplant embryo
PO:0009029anatomystamen
PO:0009031anatomysepal
PO:0009047anatomystem
PO:0025022anatomycollective leaf structure
PO:0004507developmental stageplant embryo bilateral stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 249 aa     Download sequence    Send to blast
MEGSSKGLRK GAWTAEEDSL LRLCIDKYGE GKWHQVPLRA GLNRCRKSCR LRWLNYLKPS  60
IKRGRLSNDE VDLLLRLHKL LGNRWSLIAG RLPGRTANDV KNYWNTHLSK KHESSCCKSK  120
MKKKNIISPP TTPVQKIGVF KPRPRSFSVN NGCSHLNGLP EVDLIPSCLG LKKNNVCENS  180
ITCNKDDEKD DFVNNLMNGD NMWLENLLGE NQEADAIVPE ATTAEHGATL AFDVEQLWSL  240
FDGETVELD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-2181115107B-MYB
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO2251665150.0
Genevisible260140_at0.0
Expression AtlasAT1G66390-
AtGenExpressAT1G66390-
ATTED-IIAT1G66390-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed only in leaves and siliques. {ECO:0000269|PubMed:9839469}.
Functional Description ? help Back to Top
Source Description
TAIRproduction of anthocyanin pigment 2 protein (PAP2)
UniProtTranscription activator, when associated with BHLH12/MYC1, EGL3, or GL3. Promotes the synthesis of phenylpropanoid-derived compounds such as anthocyanins. {ECO:0000269|PubMed:11148285, ECO:0000269|PubMed:15361138}.
Function -- GeneRIF ? help Back to Top
  1. the mutant myb transgene product from Arabidopsis acts as a competitive inhibitor of the native tobacco NtAN2 protein
    [PMID: 20360951]
  2. Data indicate that miR828, TAS4-siRNA81(-), and its targets MYB transcription factors PAP1 and PAP2 are responsive to sucrose.
    [PMID: 21533841]
  3. The observed reduction in anthocyanin pigmentation and AtMYB90 mRNA was phenotypically identical to the patterns seen in leaves systemically silenced for the AtMYB90 transgene.
    [PMID: 22363419]
  4. The COP1/SPA complex affects PAP1 and PAP2 both transcriptionally and post-translationally. The COP1/SPA complex controls anthocyanin levels in Arabidopsis.
    [PMID: 23425305]
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT1G66390.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By sucrose, nitrogen deficiency, ethylene, UV light and drought. {ECO:0000269|PubMed:17053893, ECO:0000269|PubMed:9839469}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Regulation -- ATRM (Manually Curated Upstream Regulators) ? help Back to Top
Source Upstream Regulator (A: Activate/R: Repress)
ATRM AT1G56650 (A)
Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top
Source Target Gene (A: Activate/R: Repress)
ATRM AT2G37260(A)
Interaction ? help Back to Top
Source Intact With
IntActSearch Q9ZTC3
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT1G66390
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF0629150.0AF062915.2 Arabidopsis thaliana putative transcription factor (MYB90) mRNA, MYB90-Col allele, complete cds.
GenBankAF3251240.0AF325124.1 Arabidopsis thaliana production of anthocyanin pigment 2 protein (PAP2) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_176813.10.0transcription factor MYB90
SwissprotQ9ZTC30.0MYB90_ARATH; Transcription factor MYB90
TrEMBLD7KTP51e-163D7KTP5_ARALL; MYB transcription factor
STRINGAT1G66390.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Representative plantOGRP5171784
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Borevitz JO,Xia Y,Blount J,Dixon RA,Lamb C
    Activation tagging identifies a conserved MYB regulator of phenylpropanoid biosynthesis.
    Plant Cell, 2000. 12(12): p. 2383-2394
    [PMID:11148285]
  3. Stracke R,Werber M,Weisshaar B
    The R2R3-MYB gene family in Arabidopsis thaliana.
    Curr. Opin. Plant Biol., 2001. 4(5): p. 447-56
    [PMID:11597504]
  4. Zhang F,Gonzalez A,Zhao M,Payne CT,Lloyd A
    A network of redundant bHLH proteins functions in all TTG1-dependent pathways of Arabidopsis.
    Development, 2003. 130(20): p. 4859-69
    [PMID:12917293]
  5. Zimmermann IM,Heim MA,Weisshaar B,Uhrig JF
    Comprehensive identification of Arabidopsis thaliana MYB transcription factors interacting with R/B-like BHLH proteins.
    Plant J., 2004. 40(1): p. 22-34
    [PMID:15361138]
  6. Yanhui C, et al.
    The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family.
    Plant Mol. Biol., 2006. 60(1): p. 107-24
    [PMID:16463103]
  7. Lea US,Slimestad R,Smedvig P,Lillo C
    Nitrogen deficiency enhances expression of specific MYB and bHLH transcription factors and accumulation of end products in the flavonoid pathway.
    Planta, 2007. 225(5): p. 1245-53
    [PMID:17053893]
  8. Ishida T, et al.
    Arabidopsis TRANSPARENT TESTA GLABRA2 is directly regulated by R2R3 MYB transcription factors and is involved in regulation of GLABRA2 transcription in epidermal differentiation.
    Plant Cell, 2007. 19(8): p. 2531-43
    [PMID:17766401]
  9. Gao P,Xin Z,Zheng ZL
    The OSU1/QUA2/TSD2-encoded putative methyltransferase is a critical modulator of carbon and nitrogen nutrient balance response in Arabidopsis.
    PLoS ONE, 2008. 3(1): p. e1387
    [PMID:18167546]
  10. Dubos C, et al.
    MYBL2 is a new regulator of flavonoid biosynthesis in Arabidopsis thaliana.
    Plant J., 2008. 55(6): p. 940-53
    [PMID:18532978]
  11. Loreti E, et al.
    Gibberellins, jasmonate and abscisic acid modulate the sucrose-induced expression of anthocyanin biosynthetic genes in Arabidopsis.
    New Phytol., 2008. 179(4): p. 1004-16
    [PMID:18537890]
  12. Olsen KM, et al.
    Temperature and nitrogen effects on regulators and products of the flavonoid pathway: experimental and kinetic model studies.
    Plant Cell Environ., 2009. 32(3): p. 286-99
    [PMID:19054348]
  13. Rowan DD, et al.
    Environmental regulation of leaf colour in red 35S:PAP1 Arabidopsis thaliana.
    New Phytol., 2009. 182(1): p. 102-15
    [PMID:19192188]
  14. Shan X,Zhang Y,Peng W,Wang Z,Xie D
    Molecular mechanism for jasmonate-induction of anthocyanin accumulation in Arabidopsis.
    J. Exp. Bot., 2009. 60(13): p. 3849-60
    [PMID:19596700]
  15. Feyissa DN,Løvdal T,Olsen KM,Slimestad R,Lillo C
    The endogenous GL3, but not EGL3, gene is necessary for anthocyanin accumulation as induced by nitrogen depletion in Arabidopsis rosette stage leaves.
    Planta, 2009. 230(4): p. 747-54
    [PMID:19621239]
  16. Rubin G,Tohge T,Matsuda F,Saito K,Scheible WR
    Members of the LBD family of transcription factors repress anthocyanin synthesis and affect additional nitrogen responses in Arabidopsis.
    Plant Cell, 2009. 21(11): p. 3567-84
    [PMID:19933203]
  17. Nelson DC, et al.
    Karrikins enhance light responses during germination and seedling development in Arabidopsis thaliana.
    Proc. Natl. Acad. Sci. U.S.A., 2010. 107(15): p. 7095-100
    [PMID:20351290]
  18. Velten J,Cakir C,Cazzonelli CI
    A spontaneous dominant-negative mutation within a 35S::AtMYB90 transgene inhibits flower pigment production in tobacco.
    PLoS ONE, 2010. 5(3): p. e9917
    [PMID:20360951]
  19. Luo QJ,Mittal A,Jia F,Rock CD
    An autoregulatory feedback loop involving PAP1 and TAS4 in response to sugars in Arabidopsis.
    Plant Mol. Biol., 2012. 80(1): p. 117-29
    [PMID:21533841]
  20. Peng Z, et al.
    Brassinosteroid enhances jasmonate-induced anthocyanin accumulation in Arabidopsis seedlings.
    J Integr Plant Biol, 2011. 53(8): p. 632-40
    [PMID:21545406]
  21. Velten J,Cakir C,Youn E,Chen J,Cazzonelli CI
    Transgene silencing and transgene-derived siRNA production in tobacco plants homozygous for an introduced AtMYB90 construct.
    PLoS ONE, 2012. 7(2): p. e30141
    [PMID:22363419]
  22. Chiu LW,Li L
    Characterization of the regulatory network of BoMYB2 in controlling anthocyanin biosynthesis in purple cauliflower.
    Planta, 2012. 236(4): p. 1153-64
    [PMID:22644767]
  23. Maier A, et al.
    Light and the E3 ubiquitin ligase COP1/SPA control the protein stability of the MYB transcription factors PAP1 and PAP2 involved in anthocyanin accumulation in Arabidopsis.
    Plant J., 2013. 74(4): p. 638-51
    [PMID:23425305]
  24. Li S,Zachgo S
    TCP3 interacts with R2R3-MYB proteins, promotes flavonoid biosynthesis and negatively regulates the auxin response in Arabidopsis thaliana.
    Plant J., 2013. 76(6): p. 901-13
    [PMID:24118612]
  25. Jin J, et al.
    An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors.
    Mol. Biol. Evol., 2015. 32(7): p. 1767-73
    [PMID:25750178]
  26. Kranz HD, et al.
    Towards functional characterisation of the members of the R2R3-MYB gene family from Arabidopsis thaliana.
    Plant J., 1998. 16(2): p. 263-76
    [PMID:9839469]